PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP14660_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 218aa    MW: 24297.5 Da    PI: 8.6365
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP14660_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-1970123356
                                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                    k+ +++keq + Lee F+++++++ +++e LA+kl+L  rqV vWFqNrRa+ k
  GSMUA_AchrUn_randomP14660_001  70 KKLRLSKEQSRLLEESFRQHHTLNPKQKEALAMKLKLRPRQVEVWFQNRRARTK 123
                                    67789***********************************************98 PP

2HD-ZIP_I/II123.87.8e-4070157290
                    HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                    kk+rlskeq++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E+++e+Lkr++ +l+een+rL+
  GSMUA_AchrUn_randomP14660_001  70 KKLRLSKEQSRLLEESFRQHHTLNPKQKEALAMKLKLRPRQVEVWFQNRRARTKLKQTEMECEYLKRCFGSLTEENRRLQ 149
                                    9******************************************************************************* PP

                    HD-ZIP_I/II  82 keveeLree 90 
                                    +eveeLr +
  GSMUA_AchrUn_randomP14660_001 150 REVEELR-A 157
                                    ******9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-1853126IPR009057Homeodomain-like
SuperFamilySSF466894.6E-1961126IPR009057Homeodomain-like
PROSITE profilePS5007116.8665125IPR001356Homeobox domain
SMARTSM003895.3E-1667129IPR001356Homeobox domain
CDDcd000865.07E-1668126No hitNo description
PfamPF000463.5E-1670123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
SMARTSM003406.4E-23125168IPR003106Leucine zipper, homeobox-associated
PfamPF021835.7E-10125158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGSLERSPSE LDLTIGVPGS SSSSYSPVWS GGGGNMRDLD INQPAYGGEE EYPMGSIEEE  60
EEEGGTPRPK KLRLSKEQSR LLEESFRQHH TLNPKQKEAL AMKLKLRPRQ VEVWFQNRRA  120
RTKLKQTEME CEYLKRCFGS LTEENRRLQR EVEELRALRV APPTVLSPHT RQPVPASSLT  180
MCPRCERVTA APHLAPSSAG GHPFRRPGAL PVAGIADG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396718.11e-138PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ0JKX11e-101HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-101HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLM0U9751e-158M0U975_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP14660_0011e-158(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.13e-60homeobox-leucine zipper protein 17